PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 676725808
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Sisymbrieae; Sisymbrium
Family TALE
Protein Properties Length: 539aa    MW: 60997.4 Da    PI: 6.2574
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
676725808genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox30.94.5e-103744111954
                HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
   Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                Fe   ++yp+++e+  LAk++gL+++qV +WF N R +
  676725808 374 FEHflHPYPKESEKMMLAKQTGLSKNQVANWFINARVR 411
                664459******************************88 PP

2BELL1161.8e-37234305172
       BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                erqelq+kk+kLl++++eVdkrY+qy++q+++++ssFe+vag gsakpYts+Al++iS hFr+L+d i+eqi
  676725808 234 ERQELQNKKSKLLTMVDEVDKRYNQYYHQMEALASSFEIVAGFGSAKPYTSVALNRISCHFRSLRDTIKEQI 305
                79*********************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005746.9E-51161303IPR006563POX domain
PfamPF075261.2E-46167301IPR006563POX domain
PROSITE profilePS5007112.552352415IPR001356Homeobox domain
SMARTSM003891.6E-9355419IPR001356Homeobox domain
CDDcd000864.68E-11355416No hitNo description
SuperFamilySSF466892.87E-17356422IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.3E-27358421IPR009057Homeodomain-like
PfamPF059209.3E-18372411IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 539 aa     Download sequence    Send to blast
MAVYYTSNVN CYQQEPLYLN HQQQQQQQQA SSSSAAASFV GENVRNEMVF IPPTTGRDVV  60
NGLQNLNGDV TGTSSDISFH DGQGLSLSLG NQISVPSFHY QQYQMGFNPN PSISVKETQP  120
FNVDEKSKEM LLLGQSDPSS GYAGNGGIGY YNGYRYNETS GGFMSSVLRS RYLKPAQNLL  180
DEVVSVKKEL NQMRKKKKGE DFNNGSKDTE GGGSGGGELS TDSNGKPIEL STVERQELQN  240
KKSKLLTMVD EVDKRYNQYY HQMEALASSF EIVAGFGSAK PYTSVALNRI SCHFRSLRDT  300
IKEQIQIIRE KLGEKGGESL DEQQGERIPR LRYLDQRLRQ QRALHQQLGM VRPAWRPQRG  360
LPENSVSALR AWLFEHFLHP YPKESEKMML AKQTGLSKNQ VANWFINARV RLWKPMIEEM  420
YKEEFGDESE LRISKSSQEP NSTNREDSSS QQQPEDNNNN NNLTYPSADT TNIVFSSEPK  480
PDRISGNDDG PQQQMNRSAD YDTLMNYHGY GLDDYRYIGG NNQQDSRFSN AHHLHDFVV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A1e-15361419563Homeobox protein Meis2
3k2a_B1e-15361419563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3526000.0AK352600.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-03-C02.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006416473.10.0hypothetical protein EUTSA_v10007267mg
SwissprotQ9FXG80.0BLH10_ARATH; BEL1-like homeodomain protein 10
TrEMBLE4MVQ30.0E4MVQ3_EUTHA; mRNA, clone: RTFL01-03-C02
TrEMBLV4MSR40.0V4MSR4_EUTSA; Uncharacterized protein
STRINGfgenesh2_kg.1__2150__AT1G19700.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM38201959
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19700.30.0BEL1-like homeodomain 10